PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BL_C1D6B6B74.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 310aa    MW: 32791.2 Da    PI: 7.544
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BL_C1D6B6B74.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.26.9e-33143200259
                            --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk+vers+edp+vv++tYeg+H h+
  Traes_5BL_C1D6B6B74.2 143 EDGYRWRKYGQKAVKNSPFPRSYYRCTNSKCTVKKRVERSSEDPSVVITTYEGQHCHH 200
                            8*******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.3E-33127201IPR003657WRKY domain
SuperFamilySSF1182902.62E-28134201IPR003657WRKY domain
PROSITE profilePS5081129.712137202IPR003657WRKY domain
SMARTSM007749.9E-39142201IPR003657WRKY domain
PfamPF031066.1E-26143200IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MAGAAGDRAE GVGGGGDWPP FAGDAFAEXX XXXXXXXXXX XXXXXXXXXL PPLDLPAASA  60
SGPVPMARSD EIMPAASGEP AGAASSCSSG DGAAAAAENA DKPQEAADAA SMKPAAAAGK  120
KGQKRARQQR FAFVTKSEVD HLEDGYRWRK YGQKAVKNSP FPRSYYRCTN SKCTVKKRVE  180
RSSEDPSVVI TTYEGQHCHH QTSFQRGGMH FHGAATVALA EQMSFVSTQQ LYNLPPLRRQ  240
QMNPASSESA VSSVPPSLQQ LNGGDELRRS TSYSPTASAV QTPSSSLVPP DVSFDMGLLG  300
DIVPPGVRNG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-261351991074Probable WRKY transcription factor 4
2lex_A3e-261351991074Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3702990.0AK370299.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2108G21.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003559239.11e-95PREDICTED: probable WRKY transcription factor 48
RefseqXP_010229633.11e-95PREDICTED: probable WRKY transcription factor 48
RefseqXP_010229639.11e-95PREDICTED: probable WRKY transcription factor 48
TrEMBLW5FHK00.0W5FHK0_WHEAT; Uncharacterized protein
STRINGMLOC_59259.21e-174(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21253796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.23e-45WRKY DNA-binding protein 57
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]